Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups


  1. Avatar for Go Science 100 pts. 14,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 14,431
  3. Avatar for Contenders 3. Contenders 47 pts. 14,304
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 14,080
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 13,893
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 13,874
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 13,710
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 13,416
  9. Avatar for Russian team 9. Russian team 2 pts. 12,917
  10. Avatar for Australia 10. Australia 1 pt. 12,869

  1. Avatar for robgee 81. robgee Lv 1 1 pt. 9,888
  2. Avatar for DScott 82. DScott Lv 1 1 pt. 9,824
  3. Avatar for kaweave2 83. kaweave2 Lv 1 1 pt. 8,930
  4. Avatar for heyubob2 84. heyubob2 Lv 1 1 pt. 6,895
  5. Avatar for ravemm2022 85. ravemm2022 Lv 1 1 pt. 6,883
  6. Avatar for bkoep 86. bkoep Lv 1 1 pt. 0
  7. Avatar for RegnadKcin 88. RegnadKcin Lv 1 1 pt. 0
  8. Avatar for jeff101 89. jeff101 Lv 1 1 pt. 0

Comments