Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 14,431
  3. Avatar for Contenders 3. Contenders 47 pts. 14,304
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 14,080
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 13,893
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 13,874
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 13,710
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 13,416
  9. Avatar for Russian team 9. Russian team 2 pts. 12,917
  10. Avatar for Australia 10. Australia 1 pt. 12,869
  1. Avatar for Mohoernchen 71. Mohoernchen Lv 1 1 pt. 10,798
  2. Avatar for Joyce_SVT 72. Joyce_SVT Lv 1 1 pt. 10,688
  3. Avatar for Larini 73. Larini Lv 1 1 pt. 10,410
  4. Avatar for RubiscoBob 74. RubiscoBob Lv 1 1 pt. 10,329
  5. Avatar for futsall 75. futsall Lv 1 1 pt. 10,236
  6. Avatar for rachelmck 76. rachelmck Lv 1 1 pt. 10,160
  7. Avatar for WinfredXR 77. WinfredXR Lv 1 1 pt. 10,160
  8. Avatar for brodlista 78. brodlista Lv 1 1 pt. 10,091
  9. Avatar for furi0us 79. furi0us Lv 1 1 pt. 10,043
  10. Avatar for kevin everington 80. kevin everington Lv 1 1 pt. 9,899

Comments