Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Beginner

Summary

Created
October 06, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,307
  2. Avatar for UPJ Biochem 25 2. UPJ Biochem 25 41 pts. 8,279
  3. Avatar for GUGITBIOTECH 3. GUGITBIOTECH 14 pts. 7,609
  4. Avatar for Coastal Biochemistry 4. Coastal Biochemistry 4 pts. 6,489
  5. Avatar for Street Smarts 5. Street Smarts 1 pt. 6,264
  6. Avatar for baconsbi4u 6. baconsbi4u 1 pt. 6,145
  7. Avatar for CH4110 Fold it! 7. CH4110 Fold it! 1 pt. 6,125
  1. Avatar for sapes22 11. sapes22 Lv 1 64 pts. 8,129
  2. Avatar for BrittanyBird 12. BrittanyBird Lv 1 62 pts. 8,128
  3. Avatar for SmiPe22 13. SmiPe22 Lv 1 59 pts. 8,105
  4. Avatar for holca22 14. holca22 Lv 1 56 pts. 8,058
  5. Avatar for lupar22 15. lupar22 Lv 1 53 pts. 8,039
  6. Avatar for gabca22 16. gabca22 Lv 1 51 pts. 8,021
  7. Avatar for nauke22 17. nauke22 Lv 1 48 pts. 7,903
  8. Avatar for gorni22 18. gorni22 Lv 1 46 pts. 7,892
  9. Avatar for dunia22 19. dunia22 Lv 1 44 pts. 7,868
  10. Avatar for croka22 20. croka22 Lv 1 42 pts. 7,858

Comments