Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Beginner

Summary

Created
October 06, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,307
  2. Avatar for UPJ Biochem 25 2. UPJ Biochem 25 41 pts. 8,279
  3. Avatar for GUGITBIOTECH 3. GUGITBIOTECH 14 pts. 7,609
  4. Avatar for Coastal Biochemistry 4. Coastal Biochemistry 4 pts. 6,489
  5. Avatar for Street Smarts 5. Street Smarts 1 pt. 6,264
  6. Avatar for baconsbi4u 6. baconsbi4u 1 pt. 6,145
  7. Avatar for CH4110 Fold it! 7. CH4110 Fold it! 1 pt. 6,125
  1. Avatar for blini22 21. blini22 Lv 1 40 pts. 7,851
  2. Avatar for RICAN22 22. RICAN22 Lv 1 38 pts. 7,834
  3. Avatar for BillGuo 23. BillGuo Lv 1 36 pts. 7,819
  4. Avatar for berro22 24. berro22 Lv 1 34 pts. 7,804
  5. Avatar for stema22 25. stema22 Lv 1 32 pts. 7,801
  6. Avatar for slashthedragon 26. slashthedragon Lv 1 31 pts. 7,790
  7. Avatar for Wirlu22 27. Wirlu22 Lv 1 29 pts. 7,776
  8. Avatar for beaab22 28. beaab22 Lv 1 27 pts. 7,754
  9. Avatar for AJournalisticPunk 29. AJournalisticPunk Lv 1 26 pts. 7,721
  10. Avatar for RichGuilmain 30. RichGuilmain Lv 1 25 pts. 7,688

Comments