Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Beginner

Summary

Created
October 06, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,307
  2. Avatar for UPJ Biochem 25 2. UPJ Biochem 25 41 pts. 8,279
  3. Avatar for GUGITBIOTECH 3. GUGITBIOTECH 14 pts. 7,609
  4. Avatar for Coastal Biochemistry 4. Coastal Biochemistry 4 pts. 6,489
  5. Avatar for Street Smarts 5. Street Smarts 1 pt. 6,264
  6. Avatar for baconsbi4u 6. baconsbi4u 1 pt. 6,145
  7. Avatar for CH4110 Fold it! 7. CH4110 Fold it! 1 pt. 6,125
  1. Avatar for AmyO 31. AmyO Lv 1 23 pts. 7,687
  2. Avatar for connerhart7 32. connerhart7 Lv 1 22 pts. 7,675
  3. Avatar for gauty7 33. gauty7 Lv 1 21 pts. 7,668
  4. Avatar for mthibodeau1_556 34. mthibodeau1_556 Lv 1 20 pts. 7,646
  5. Avatar for basme22 35. basme22 Lv 1 18 pts. 7,622
  6. Avatar for Olejo22 36. Olejo22 Lv 1 17 pts. 7,617
  7. Avatar for 121910101028 Anuroop 37. 121910101028 Anuroop Lv 1 16 pts. 7,609
  8. Avatar for campeunice 38. campeunice Lv 1 15 pts. 7,587
  9. Avatar for Sarfaraz Mohammed 39. Sarfaraz Mohammed Lv 1 15 pts. 7,586
  10. Avatar for Brianna0331 40. Brianna0331 Lv 1 14 pts. 7,580

Comments