Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 9,942
  2. Avatar for Team China 12. Team China 1 pt. 9,752
  3. Avatar for Window Group 13. Window Group 1 pt. 7,735
  1. Avatar for Sandrix72 11. Sandrix72 Lv 1 55 pts. 11,300
  2. Avatar for g_b 12. g_b Lv 1 52 pts. 11,299
  3. Avatar for Pazithi 13. Pazithi Lv 1 49 pts. 11,289
  4. Avatar for infjamc 14. infjamc Lv 1 45 pts. 11,286
  5. Avatar for MicElephant 15. MicElephant Lv 1 43 pts. 11,268
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 40 pts. 11,124
  7. Avatar for BackBuffer 17. BackBuffer Lv 1 37 pts. 11,122
  8. Avatar for gmn 18. gmn Lv 1 35 pts. 11,075
  9. Avatar for ucad 19. ucad Lv 1 32 pts. 10,970
  10. Avatar for Betty Jo Bialosky 20. Betty Jo Bialosky Lv 1 30 pts. 10,968

Comments