Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,648
  2. Avatar for Go Science 2. Go Science 65 pts. 11,543
  3. Avatar for Contenders 3. Contenders 41 pts. 11,407
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,310
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 11,289
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 11,124
  7. Avatar for Firesign 7. Firesign 4 pts. 10,968
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 10,907
  9. Avatar for Australia 9. Australia 1 pt. 10,436
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,256
  1. Avatar for Sandrix72 11. Sandrix72 Lv 1 55 pts. 11,300
  2. Avatar for g_b 12. g_b Lv 1 52 pts. 11,299
  3. Avatar for Pazithi 13. Pazithi Lv 1 49 pts. 11,289
  4. Avatar for infjamc 14. infjamc Lv 1 45 pts. 11,286
  5. Avatar for MicElephant 15. MicElephant Lv 1 43 pts. 11,268
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 40 pts. 11,124
  7. Avatar for BackBuffer 17. BackBuffer Lv 1 37 pts. 11,122
  8. Avatar for gmn 18. gmn Lv 1 35 pts. 11,075
  9. Avatar for ucad 19. ucad Lv 1 32 pts. 10,970
  10. Avatar for Betty Jo Bialosky 20. Betty Jo Bialosky Lv 1 30 pts. 10,968

Comments