Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 9,942
  2. Avatar for Team China 12. Team China 1 pt. 9,752
  3. Avatar for Window Group 13. Window Group 1 pt. 7,735
  1. Avatar for zbp 61. zbp Lv 1 1 pt. 10,242
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 10,213
  3. Avatar for Dr.Sillem 63. Dr.Sillem Lv 1 1 pt. 10,177
  4. Avatar for BrittanyBird 64. BrittanyBird Lv 1 1 pt. 10,153
  5. Avatar for Catherwood 65. Catherwood Lv 1 1 pt. 10,146
  6. Avatar for VINCENTJAMES1 66. VINCENTJAMES1 Lv 1 1 pt. 10,142
  7. Avatar for rinze 67. rinze Lv 1 1 pt. 10,140
  8. Avatar for pfirth 68. pfirth Lv 1 1 pt. 10,139
  9. Avatar for carxo 69. carxo Lv 1 1 pt. 10,110
  10. Avatar for kludbrook 70. kludbrook Lv 1 1 pt. 10,086

Comments