Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,648
  2. Avatar for Go Science 2. Go Science 65 pts. 11,543
  3. Avatar for Contenders 3. Contenders 41 pts. 11,407
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,310
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 11,289
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 11,124
  7. Avatar for Firesign 7. Firesign 4 pts. 10,968
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 10,907
  9. Avatar for Australia 9. Australia 1 pt. 10,436
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,256
  1. Avatar for zbp 61. zbp Lv 1 1 pt. 10,242
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 10,213
  3. Avatar for Dr.Sillem 63. Dr.Sillem Lv 1 1 pt. 10,177
  4. Avatar for BrittanyBird 64. BrittanyBird Lv 1 1 pt. 10,153
  5. Avatar for Catherwood 65. Catherwood Lv 1 1 pt. 10,146
  6. Avatar for VINCENTJAMES1 66. VINCENTJAMES1 Lv 1 1 pt. 10,142
  7. Avatar for rinze 67. rinze Lv 1 1 pt. 10,140
  8. Avatar for pfirth 68. pfirth Lv 1 1 pt. 10,139
  9. Avatar for carxo 69. carxo Lv 1 1 pt. 10,110
  10. Avatar for kludbrook 70. kludbrook Lv 1 1 pt. 10,086

Comments