Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 9,942
  2. Avatar for Team China 12. Team China 1 pt. 9,752
  3. Avatar for Window Group 13. Window Group 1 pt. 7,735

  1. Avatar for yuki000 71. yuki000 Lv 1 1 pt. 10,033
  2. Avatar for RubiscoBob 72. RubiscoBob Lv 1 1 pt. 9,942
  3. Avatar for toxiko 73. toxiko Lv 1 1 pt. 9,921
  4. Avatar for vyndaquel 74. vyndaquel Lv 1 1 pt. 9,895
  5. Avatar for Nihil192 75. Nihil192 Lv 1 1 pt. 9,891
  6. Avatar for Hellcat6 76. Hellcat6 Lv 1 1 pt. 9,880
  7. Avatar for furi0us 77. furi0us Lv 1 1 pt. 9,852
  8. Avatar for DipsyDoodle2016 78. DipsyDoodle2016 Lv 1 1 pt. 9,825
  9. Avatar for ReddyGamin 79. ReddyGamin Lv 1 1 pt. 9,774
  10. Avatar for Crossed Sticks 80. Crossed Sticks Lv 1 1 pt. 9,755

Comments