Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,648
  2. Avatar for Go Science 2. Go Science 65 pts. 11,543
  3. Avatar for Contenders 3. Contenders 41 pts. 11,407
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,310
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 11,289
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 11,124
  7. Avatar for Firesign 7. Firesign 4 pts. 10,968
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 10,907
  9. Avatar for Australia 9. Australia 1 pt. 10,436
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,256
  1. Avatar for yuki000 71. yuki000 Lv 1 1 pt. 10,033
  2. Avatar for RubiscoBob 72. RubiscoBob Lv 1 1 pt. 9,942
  3. Avatar for toxiko 73. toxiko Lv 1 1 pt. 9,921
  4. Avatar for vyndaquel 74. vyndaquel Lv 1 1 pt. 9,895
  5. Avatar for Nihil192 75. Nihil192 Lv 1 1 pt. 9,891
  6. Avatar for Hellcat6 76. Hellcat6 Lv 1 1 pt. 9,880
  7. Avatar for furi0us 77. furi0us Lv 1 1 pt. 9,852
  8. Avatar for DipsyDoodle2016 78. DipsyDoodle2016 Lv 1 1 pt. 9,825
  9. Avatar for ReddyGamin 79. ReddyGamin Lv 1 1 pt. 9,774
  10. Avatar for Crossed Sticks 80. Crossed Sticks Lv 1 1 pt. 9,755

Comments