Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,648
  2. Avatar for Go Science 2. Go Science 65 pts. 11,543
  3. Avatar for Contenders 3. Contenders 41 pts. 11,407
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,310
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 11,289
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 11,124
  7. Avatar for Firesign 7. Firesign 4 pts. 10,968
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 10,907
  9. Avatar for Australia 9. Australia 1 pt. 10,436
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,256
  1. Avatar for akaaka 21. akaaka Lv 1 28 pts. 10,954
  2. Avatar for blazegeek 22. blazegeek Lv 1 26 pts. 10,951
  3. Avatar for maithra 23. maithra Lv 1 24 pts. 10,947
  4. Avatar for hada 24. hada Lv 1 22 pts. 10,945
  5. Avatar for phi16 25. phi16 Lv 1 21 pts. 10,934
  6. Avatar for fpc 26. fpc Lv 1 19 pts. 10,932
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 18 pts. 10,907
  8. Avatar for RegnadKcin 28. RegnadKcin Lv 1 17 pts. 10,888
  9. Avatar for sallallami 29. sallallami Lv 1 15 pts. 10,857
  10. Avatar for NPrincipi 30. NPrincipi Lv 1 14 pts. 10,854

Comments