Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,648
  2. Avatar for Go Science 2. Go Science 65 pts. 11,543
  3. Avatar for Contenders 3. Contenders 41 pts. 11,407
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,310
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 11,289
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 11,124
  7. Avatar for Firesign 7. Firesign 4 pts. 10,968
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 10,907
  9. Avatar for Australia 9. Australia 1 pt. 10,436
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,256
  1. Avatar for equilibria 41. equilibria Lv 1 5 pts. 10,670
  2. Avatar for grogar7 42. grogar7 Lv 1 5 pts. 10,653
  3. Avatar for alcor29 43. alcor29 Lv 1 4 pts. 10,648
  4. Avatar for CharaLilith 44. CharaLilith Lv 1 4 pts. 10,606
  5. Avatar for DScott 45. DScott Lv 1 4 pts. 10,571
  6. Avatar for Gonegirl 46. Gonegirl Lv 1 3 pts. 10,526
  7. Avatar for bamh 47. bamh Lv 1 3 pts. 10,507
  8. Avatar for rezaefar 48. rezaefar Lv 1 3 pts. 10,505
  9. Avatar for JordanXion 49. JordanXion Lv 1 2 pts. 10,493
  10. Avatar for Trajan464 50. Trajan464 Lv 1 2 pts. 10,491

Comments