Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 8,601
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,628
  3. Avatar for Window Group 13. Window Group 1 pt. 0

  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 57 pts. 10,305
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 54 pts. 10,276
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 51 pts. 10,274
  4. Avatar for akaaka 14. akaaka Lv 1 48 pts. 10,251
  5. Avatar for BackBuffer 15. BackBuffer Lv 1 45 pts. 10,241
  6. Avatar for g_b 16. g_b Lv 1 42 pts. 10,209
  7. Avatar for Idiotboy 17. Idiotboy Lv 1 39 pts. 10,193
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 37 pts. 10,084
  9. Avatar for blazegeek 19. blazegeek Lv 1 35 pts. 10,052
  10. Avatar for SemperRabbit 20. SemperRabbit Lv 1 32 pts. 10,013

Comments