Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 8,601
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,628
  3. Avatar for Window Group 13. Window Group 1 pt. 0

  1. Avatar for jausmh 31. jausmh Lv 1 15 pts. 9,801
  2. Avatar for BarrySampson 32. BarrySampson Lv 1 14 pts. 9,784
  3. Avatar for Steven Pletsch 33. Steven Pletsch Lv 1 13 pts. 9,763
  4. Avatar for phi16 34. phi16 Lv 1 12 pts. 9,740
  5. Avatar for maithra 35. maithra Lv 1 11 pts. 9,632
  6. Avatar for hada 36. hada Lv 1 10 pts. 9,598
  7. Avatar for roarshock 37. roarshock Lv 1 9 pts. 9,590
  8. Avatar for NPrincipi 38. NPrincipi Lv 1 8 pts. 9,417
  9. Avatar for Alistair69 39. Alistair69 Lv 1 8 pts. 9,406
  10. Avatar for Oransche 40. Oransche Lv 1 7 pts. 9,330

Comments