Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary


Created
December 01, 2022
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Go Science 100 pts. 14,761
  2. Avatar for Rechenkraft.net 2. Rechenkraft.net 24 pts. 14,452
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 4 pts. 14,452
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 14,060
  5. Avatar for Tableau ACE 5. Tableau ACE 1 pt. 12,898

  1. Avatar for EllaPerez048 91. EllaPerez048 Lv 1 1 pt. 11,405
  2. Avatar for coelloch 92. coelloch Lv 1 1 pt. 11,405
  3. Avatar for Emman 93. Emman Lv 1 1 pt. 11,405
  4. Avatar for Kormi 94. Kormi Lv 1 1 pt. 11,405

Comments