Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary

Created
December 01, 2022
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,761
  2. Avatar for Rechenkraft.net 2. Rechenkraft.net 24 pts. 14,452
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 4 pts. 14,452
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 14,060
  5. Avatar for Tableau ACE 5. Tableau ACE 1 pt. 12,898
  1. Avatar for Nicole Bobe 61. Nicole Bobe Lv 1 1 pt. 13,910
  2. Avatar for cache 62. cache Lv 1 1 pt. 13,895
  3. Avatar for TC2020232 63. TC2020232 Lv 1 1 pt. 13,894
  4. Avatar for MA_MAHUSAY 64. MA_MAHUSAY Lv 1 1 pt. 13,885
  5. Avatar for frances 65. frances Lv 1 1 pt. 13,873
  6. Avatar for Kassandra Gallenero 66. Kassandra Gallenero Lv 1 1 pt. 13,870
  7. Avatar for Porus 67. Porus Lv 1 1 pt. 13,869
  8. Avatar for ritch 68. ritch Lv 1 1 pt. 13,857
  9. Avatar for rayray33 69. rayray33 Lv 1 1 pt. 13,846
  10. Avatar for jeanrogue 70. jeanrogue Lv 1 1 pt. 13,814

Comments