Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary

Created
December 01, 2022
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,761
  2. Avatar for Rechenkraft.net 2. Rechenkraft.net 24 pts. 14,452
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 4 pts. 14,452
  4. Avatar for BBIO WARRIOR 4. BBIO WARRIOR 1 pt. 14,060
  5. Avatar for Tableau ACE 5. Tableau ACE 1 pt. 12,898
  1. Avatar for Lyann Marie 51. Lyann Marie Lv 1 3 pts. 13,927
  2. Avatar for loisee 52. loisee Lv 1 2 pts. 13,924
  3. Avatar for bblaycne 53. bblaycne Lv 1 2 pts. 13,920
  4. Avatar for Connie Rose 54. Connie Rose Lv 1 2 pts. 13,920
  5. Avatar for Alj_olivares 55. Alj_olivares Lv 1 2 pts. 13,918
  6. Avatar for Ephraim03 56. Ephraim03 Lv 1 2 pts. 13,917
  7. Avatar for cherryb 57. cherryb Lv 1 1 pt. 13,917
  8. Avatar for glomie 58. glomie Lv 1 1 pt. 13,917
  9. Avatar for frnclsh 59. frnclsh Lv 1 1 pt. 13,915
  10. Avatar for blurshie 60. blurshie Lv 1 1 pt. 13,912

Comments