Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for Idiotboy 21. Idiotboy Lv 1 43 pts. 9,887
  2. Avatar for Aubade01 22. Aubade01 Lv 1 41 pts. 9,879
  3. Avatar for alcor29 23. alcor29 Lv 1 39 pts. 9,868
  4. Avatar for fiendish_ghoul 24. fiendish_ghoul Lv 1 38 pts. 9,841
  5. Avatar for guineapig 25. guineapig Lv 1 36 pts. 9,819
  6. Avatar for blazegeek 26. blazegeek Lv 1 34 pts. 9,809
  7. Avatar for BackBuffer 27. BackBuffer Lv 1 33 pts. 9,750
  8. Avatar for hada 28. hada Lv 1 31 pts. 9,725
  9. Avatar for akaaka 29. akaaka Lv 1 30 pts. 9,714
  10. Avatar for AlphaFold2 30. AlphaFold2 Lv 1 28 pts. 9,689

Comments