Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Team South Africa 11. Team South Africa 1 pt. 9,032
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,868
  3. Avatar for Team China 13. Team China 1 pt. 8,842
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 8,815
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 2,942
  1. Avatar for lezhe 71. lezhe Lv 1 2 pts. 8,842
  2. Avatar for Larini 72. Larini Lv 1 2 pts. 8,834
  3. Avatar for angeluBSPS3B 73. angeluBSPS3B Lv 1 2 pts. 8,815
  4. Avatar for fae 74. fae Lv 1 2 pts. 8,814
  5. Avatar for deemzoom 75. deemzoom Lv 1 2 pts. 8,806
  6. Avatar for EC2020431 76. EC2020431 Lv 1 2 pts. 8,796
  7. Avatar for nicolewong123 77. nicolewong123 Lv 1 2 pts. 8,787
  8. Avatar for Mohoernchen 78. Mohoernchen Lv 1 2 pts. 8,778
  9. Avatar for vyndaquel 79. vyndaquel Lv 1 1 pt. 8,717
  10. Avatar for CFirmalalala 80. CFirmalalala Lv 1 1 pt. 8,707

Comments