Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups


  1. Avatar for L'Alliance Francophone 11. L'Alliance Francophone 1 pt. 20,909
  2. Avatar for Australia 12. Australia 1 pt. 20,830
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 20,829
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 19,867
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 19,745
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 19,639

  1. Avatar for s2021369 91. s2021369 Lv 1 1 pt. 19,369
  2. Avatar for ynsie 92. ynsie Lv 1 1 pt. 19,045
  3. Avatar for sugarplum 93. sugarplum Lv 1 1 pt. 19,045
  4. Avatar for kurenan 94. kurenan Lv 1 1 pt. 19,043
  5. Avatar for copter15399 95. copter15399 Lv 1 1 pt. 18,982
  6. Avatar for Cyrelle 96. Cyrelle Lv 1 1 pt. 18,933
  7. Avatar for abskebabs 97. abskebabs Lv 1 1 pt. 18,779
  8. Avatar for Bollo 98. Bollo Lv 1 1 pt. 18,608
  9. Avatar for Gonzaga 99. Gonzaga Lv 1 1 pt. 13,994
  10. Avatar for Joryell 100. Joryell Lv 1 1 pt. 10,183

Comments