Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups


  1. Avatar for L'Alliance Francophone 11. L'Alliance Francophone 1 pt. 20,909
  2. Avatar for Australia 12. Australia 1 pt. 20,830
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 20,829
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 19,867
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 19,745
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 19,639

  1. Avatar for ProfVince 41. ProfVince Lv 1 9 pts. 20,873
  2. Avatar for Crossed Sticks 42. Crossed Sticks Lv 1 8 pts. 20,861
  3. Avatar for Wiz kid 43. Wiz kid Lv 1 8 pts. 20,830
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 7 pts. 20,829
  5. Avatar for 2021797 45. 2021797 Lv 1 7 pts. 20,685
  6. Avatar for sitlux 46. sitlux Lv 1 6 pts. 20,642
  7. Avatar for blazegeek 47. blazegeek Lv 1 6 pts. 20,600
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 5 pts. 20,385
  9. Avatar for Vinara 49. Vinara Lv 1 5 pts. 20,370
  10. Avatar for fpc 50. fpc Lv 1 4 pts. 20,324

Comments