Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups

  1. Avatar for L'Alliance Francophone 11. L'Alliance Francophone 1 pt. 20,909
  2. Avatar for Australia 12. Australia 1 pt. 20,830
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 20,829
  4. Avatar for BBIO WARRIOR 14. BBIO WARRIOR 1 pt. 19,867
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 19,745
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 19,639
  1. Avatar for Larini 81. Larini Lv 1 1 pt. 19,692
  2. Avatar for Mohoernchen 82. Mohoernchen Lv 1 1 pt. 19,678
  3. Avatar for Connie Rose 83. Connie Rose Lv 1 1 pt. 19,658
  4. Avatar for izzgood 84. izzgood Lv 1 1 pt. 19,639
  5. Avatar for Hanxin1234 85. Hanxin1234 Lv 1 1 pt. 19,632
  6. Avatar for Tina1515 86. Tina1515 Lv 1 1 pt. 19,603
  7. Avatar for Gnny18 87. Gnny18 Lv 1 1 pt. 19,590
  8. Avatar for vincentlaurence 88. vincentlaurence Lv 1 1 pt. 19,483
  9. Avatar for Nicole Bobe 89. Nicole Bobe Lv 1 1 pt. 19,467
  10. Avatar for ralphlloydpioquinto 90. ralphlloydpioquinto Lv 1 1 pt. 19,414

Comments