Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups


  1. Avatar for Go Science 100 pts. 21,498
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 21,467
  3. Avatar for Contenders 3. Contenders 49 pts. 21,386
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 21,335
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 21,240
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 21,236
  7. Avatar for Hold My Beer 7. Hold My Beer 8 pts. 21,198
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 21,187
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 20,972
  10. Avatar for VeFold 10. VeFold 2 pts. 20,972

  1. Avatar for maithra 11. maithra Lv 1 61 pts. 21,316
  2. Avatar for gmn 12. gmn Lv 1 57 pts. 21,310
  3. Avatar for Nicm25 13. Nicm25 Lv 1 54 pts. 21,305
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 51 pts. 21,302
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 49 pts. 21,266
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 46 pts. 21,236
  7. Avatar for alcor29 17. alcor29 Lv 1 43 pts. 21,201
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 41 pts. 21,198
  9. Avatar for equilibria 19. equilibria Lv 1 39 pts. 21,195
  10. Avatar for grogar7 20. grogar7 Lv 1 37 pts. 21,194

Comments