Placeholder image of a protein
Icon representing a puzzle

2241: Electron Density Reconstruction 20

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
December 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRRP

Top groups


  1. Avatar for Go Science 100 pts. 21,498
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 21,467
  3. Avatar for Contenders 3. Contenders 49 pts. 21,386
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 21,335
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 21,240
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 21,236
  7. Avatar for Hold My Beer 7. Hold My Beer 8 pts. 21,198
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 21,187
  9. Avatar for AlphaFold 9. AlphaFold 3 pts. 20,972
  10. Avatar for VeFold 10. VeFold 2 pts. 20,972

  1. Avatar for roarshock 31. roarshock Lv 1 18 pts. 21,076
  2. Avatar for rezaefar 32. rezaefar Lv 1 17 pts. 21,071
  3. Avatar for t.m.roach 33. t.m.roach Lv 1 16 pts. 21,067
  4. Avatar for bamh 34. bamh Lv 1 15 pts. 21,066
  5. Avatar for Oransche 35. Oransche Lv 1 14 pts. 20,992
  6. Avatar for AlphaFold2 36. AlphaFold2 Lv 1 13 pts. 20,972
  7. Avatar for Gonegirl 37. Gonegirl Lv 1 12 pts. 20,930
  8. Avatar for Trajan464 38. Trajan464 Lv 1 11 pts. 20,929
  9. Avatar for Alistair69 39. Alistair69 Lv 1 11 pts. 20,909
  10. Avatar for hada 40. hada Lv 1 10 pts. 20,890

Comments