Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 11,274
  2. Avatar for Australia 12. Australia 1 pt. 11,268
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 11,246
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 11,131
  1. Avatar for SemperRabbit 41. SemperRabbit Lv 1 3 pts. 11,633
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 3 pts. 11,606
  3. Avatar for georg137 43. georg137 Lv 1 2 pts. 11,595
  4. Avatar for Alistair69 44. Alistair69 Lv 1 2 pts. 11,477
  5. Avatar for bamh 45. bamh Lv 1 2 pts. 11,455
  6. Avatar for Merf 46. Merf Lv 1 2 pts. 11,379
  7. Avatar for heather-1 47. heather-1 Lv 1 2 pts. 11,376
  8. Avatar for Vinara 48. Vinara Lv 1 1 pt. 11,376
  9. Avatar for sitlux 49. sitlux Lv 1 1 pt. 11,363
  10. Avatar for NickMihal 50. NickMihal Lv 1 1 pt. 11,329

Comments