Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,882
  2. Avatar for Go Science 2. Go Science 68 pts. 12,556
  3. Avatar for Contenders 3. Contenders 44 pts. 12,503
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 12,458
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 12,230
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 12,124
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,113
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 12,039
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 12,030
  10. Avatar for Team China 10. Team China 1 pt. 11,778
  1. Avatar for SemperRabbit 41. SemperRabbit Lv 1 3 pts. 11,633
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 3 pts. 11,606
  3. Avatar for georg137 43. georg137 Lv 1 2 pts. 11,595
  4. Avatar for Alistair69 44. Alistair69 Lv 1 2 pts. 11,477
  5. Avatar for bamh 45. bamh Lv 1 2 pts. 11,455
  6. Avatar for Merf 46. Merf Lv 1 2 pts. 11,379
  7. Avatar for heather-1 47. heather-1 Lv 1 2 pts. 11,376
  8. Avatar for Vinara 48. Vinara Lv 1 1 pt. 11,376
  9. Avatar for sitlux 49. sitlux Lv 1 1 pt. 11,363
  10. Avatar for NickMihal 50. NickMihal Lv 1 1 pt. 11,329

Comments