Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary

Created
January 12, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,039
  2. Avatar for CHEM1210/1020 TTU 2. CHEM1210/1020 TTU 1 pt. 11,685
  1. Avatar for nralobai 11. nralobai Lv 1 8 pts. 13,868
  2. Avatar for Titanus 12. Titanus Lv 1 6 pts. 13,766
  3. Avatar for smilla28 13. smilla28 Lv 1 4 pts. 13,051
  4. Avatar for hi1000 14. hi1000 Lv 1 3 pts. 12,984
  5. Avatar for hannahc315 15. hannahc315 Lv 1 2 pts. 12,306
  6. Avatar for 2023SpringSarahKateMiller 16. 2023SpringSarahKateMiller Lv 1 2 pts. 11,685
  7. Avatar for mfen121 17. mfen121 Lv 1 1 pt. 11,607
  8. Avatar for edahay23 18. edahay23 Lv 1 1 pt. 11,598
  9. Avatar for @Yundan 19. @Yundan Lv 1 1 pt. 11,522
  10. Avatar for spring2023GaryButler 20. spring2023GaryButler Lv 1 1 pt. 11,514

Comments