Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary

Created
January 12, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,039
  2. Avatar for CHEM1210/1020 TTU 2. CHEM1210/1020 TTU 1 pt. 11,685
  1. Avatar for rosie4loop
    1. rosie4loop Lv 1
    100 pts. 15,204
  2. Avatar for cs09736 2. cs09736 Lv 1 82 pts. 15,006
  3. Avatar for amakedon 3. amakedon Lv 1 66 pts. 14,284
  4. Avatar for Porus 4. Porus Lv 1 53 pts. 14,145
  5. Avatar for WuWTq 5. WuWTq Lv 1 42 pts. 14,069
  6. Avatar for NickMihal 6. NickMihal Lv 1 33 pts. 14,039
  7. Avatar for adnanm4 7. adnanm4 Lv 1 26 pts. 14,038
  8. Avatar for Deleted player 8. Deleted player 20 pts. 13,975
  9. Avatar for DoughnutFish 9. DoughnutFish Lv 1 15 pts. 13,971
  10. Avatar for vytran2306 10. vytran2306 Lv 1 11 pts. 13,916

Comments