Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since about 3 years ago

Beginner

Summary

Created
January 12, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,039
  2. Avatar for CHEM1210/1020 TTU 2. CHEM1210/1020 TTU 1 pt. 11,685
  1. Avatar for giselleq 21. giselleq Lv 1 1 pt. 11,513
  2. Avatar for bpratt06 22. bpratt06 Lv 1 1 pt. 11,409
  3. Avatar for kalaff 23. kalaff Lv 1 1 pt. 11,405
  4. Avatar for Vishwa patel 24. Vishwa patel Lv 1 1 pt. 11,405
  5. Avatar for tigersfan30 25. tigersfan30 Lv 1 1 pt. 11,405
  6. Avatar for cristina125617 26. cristina125617 Lv 1 1 pt. 11,405

Comments