Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,258
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,877
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,735
  4. Avatar for PFMD 14. PFMD 1 pt. 9,999
  1. Avatar for stomjoh 21. stomjoh Lv 1 24 pts. 11,588
  2. Avatar for akaaka 22. akaaka Lv 1 22 pts. 11,588
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 20 pts. 11,556
  4. Avatar for maithra 24. maithra Lv 1 18 pts. 11,555
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 17 pts. 11,535
  6. Avatar for roarshock 26. roarshock Lv 1 15 pts. 11,534
  7. Avatar for manu8170 27. manu8170 Lv 1 14 pts. 11,506
  8. Avatar for alcor29 28. alcor29 Lv 1 13 pts. 11,494
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 12 pts. 11,492
  10. Avatar for Steven Pletsch 30. Steven Pletsch Lv 1 11 pts. 11,488

Comments