Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,258
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,877
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,735
  4. Avatar for PFMD 14. PFMD 1 pt. 9,999

  1. Avatar for Joanna_H 31. Joanna_H Lv 1 10 pts. 11,455
  2. Avatar for ProfVince 32. ProfVince Lv 1 9 pts. 11,448
  3. Avatar for Hillbillie 33. Hillbillie Lv 1 8 pts. 11,445
  4. Avatar for grogar7 34. grogar7 Lv 1 7 pts. 11,443
  5. Avatar for equilibria 35. equilibria Lv 1 6 pts. 11,440
  6. Avatar for Wiz kid 36. Wiz kid Lv 1 6 pts. 11,407
  7. Avatar for blazegeek 37. blazegeek Lv 1 5 pts. 11,404
  8. Avatar for hada 38. hada Lv 1 5 pts. 11,390
  9. Avatar for Karlheinz 39. Karlheinz Lv 1 4 pts. 11,374
  10. Avatar for bamh 40. bamh Lv 1 4 pts. 11,373

Comments