Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,258
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,877
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,735
  4. Avatar for PFMD 14. PFMD 1 pt. 9,999

  1. Avatar for ucad 51. ucad Lv 1 1 pt. 11,261
  2. Avatar for ShadowTactics 52. ShadowTactics Lv 1 1 pt. 11,258
  3. Avatar for Crossed Sticks 53. Crossed Sticks Lv 1 1 pt. 11,240
  4. Avatar for Vinara 54. Vinara Lv 1 1 pt. 11,237
  5. Avatar for antibot215 55. antibot215 Lv 1 1 pt. 11,237
  6. Avatar for Gonegirl 56. Gonegirl Lv 1 1 pt. 11,234
  7. Avatar for Skippysk8s 57. Skippysk8s Lv 1 1 pt. 11,178
  8. Avatar for Arne Heessels 58. Arne Heessels Lv 1 1 pt. 11,146
  9. Avatar for Merf 59. Merf Lv 1 1 pt. 11,080
  10. Avatar for fiendish_ghoul 60. fiendish_ghoul Lv 1 1 pt. 11,060

Comments