Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,258
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,877
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,735
  4. Avatar for PFMD 14. PFMD 1 pt. 9,999

  1. Avatar for Larini 61. Larini Lv 1 1 pt. 10,997
  2. Avatar for Dr.Sillem 62. Dr.Sillem Lv 1 1 pt. 10,988
  3. Avatar for carxo 63. carxo Lv 1 1 pt. 10,961
  4. Avatar for DScott 64. DScott Lv 1 1 pt. 10,939
  5. Avatar for vyndaquel 65. vyndaquel Lv 1 1 pt. 10,921
  6. Avatar for cs09736 66. cs09736 Lv 1 1 pt. 10,920
  7. Avatar for Alistair69 67. Alistair69 Lv 1 1 pt. 10,883
  8. Avatar for Savas 68. Savas Lv 1 1 pt. 10,877
  9. Avatar for heyubob 69. heyubob Lv 1 1 pt. 10,869
  10. Avatar for rinze 70. rinze Lv 1 1 pt. 10,857

Comments