Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,807
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,765
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 11,696
  4. Avatar for Contenders 4. Contenders 27 pts. 11,694
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,640
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,599
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,556
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,455
  9. Avatar for Australia 9. Australia 1 pt. 11,407
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 11,297
  1. Avatar for Mohoernchen 71. Mohoernchen Lv 1 1 pt. 10,830
  2. Avatar for zbp 72. zbp Lv 1 1 pt. 10,794
  3. Avatar for elv 73. elv Lv 1 1 pt. 10,787
  4. Avatar for alyssa_d_V2.0 74. alyssa_d_V2.0 Lv 1 1 pt. 10,735
  5. Avatar for Swapper242 75. Swapper242 Lv 1 1 pt. 10,725
  6. Avatar for Sammy3c2b1a0 76. Sammy3c2b1a0 Lv 1 1 pt. 10,691
  7. Avatar for asw2022 77. asw2022 Lv 1 1 pt. 9,999
  8. Avatar for scotj14 78. scotj14 Lv 1 1 pt. 7,731
  9. Avatar for britanym 79. britanym Lv 1 1 pt. 7,731
  10. Avatar for georg137 80. georg137 Lv 1 1 pt. 7,731

Comments