Icon representing a puzzle

2256: Revisiting Puzzle 64: Thioredoxin

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
January 25, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,807
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,765
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 11,696
  4. Avatar for Contenders 4. Contenders 27 pts. 11,694
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,640
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,599
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,556
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,455
  9. Avatar for Australia 9. Australia 1 pt. 11,407
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 11,297
  1. Avatar for t.m.roach 41. t.m.roach Lv 1 3 pts. 11,372
  2. Avatar for Idiotboy 42. Idiotboy Lv 1 3 pts. 11,365
  3. Avatar for carsonfb 43. carsonfb Lv 1 3 pts. 11,350
  4. Avatar for sitlux 44. sitlux Lv 1 2 pts. 11,332
  5. Avatar for Silvercraft 45. Silvercraft Lv 1 2 pts. 11,316
  6. Avatar for RichGuilmain 46. RichGuilmain Lv 1 2 pts. 11,310
  7. Avatar for AlphaFold2 47. AlphaFold2 Lv 1 2 pts. 11,297
  8. Avatar for AlkiP0Ps 48. AlkiP0Ps Lv 1 2 pts. 11,295
  9. Avatar for heather-1 49. heather-1 Lv 1 1 pt. 11,269
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 11,265

Comments