Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 29,895
  2. Avatar for Void Crushers 2. Void Crushers 63 pts. 29,889
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 29,886
  4. Avatar for Contenders 4. Contenders 21 pts. 29,794
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 29,762
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 29,632
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 29,621
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 29,574
  9. Avatar for Australia 9. Australia 1 pt. 29,509
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 29,430
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 48 pts. 29,762
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 44 pts. 29,760
  3. Avatar for guineapig 13. guineapig Lv 1 41 pts. 29,757
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 37 pts. 29,746
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 34 pts. 29,737
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 32 pts. 29,728
  7. Avatar for Steven Pletsch 17. Steven Pletsch Lv 1 29 pts. 29,728
  8. Avatar for toshiue 18. toshiue Lv 1 27 pts. 29,714
  9. Avatar for spmm 19. spmm Lv 1 24 pts. 29,704
  10. Avatar for alcor29 20. alcor29 Lv 1 22 pts. 29,686

Comments

MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.