Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 29,895
  2. Avatar for Void Crushers 2. Void Crushers 63 pts. 29,889
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 29,886
  4. Avatar for Contenders 4. Contenders 21 pts. 29,794
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 29,762
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 29,632
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 29,621
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 29,574
  9. Avatar for Australia 9. Australia 1 pt. 29,509
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 29,430
  1. Avatar for NPrincipi 21. NPrincipi Lv 1 20 pts. 29,678
  2. Avatar for stomjoh 22. stomjoh Lv 1 18 pts. 29,668
  3. Avatar for bamh 23. bamh Lv 1 17 pts. 29,663
  4. Avatar for maithra 24. maithra Lv 1 15 pts. 29,648
  5. Avatar for Silvercraft 25. Silvercraft Lv 1 14 pts. 29,639
  6. Avatar for phi16 26. phi16 Lv 1 12 pts. 29,638
  7. Avatar for fpc 27. fpc Lv 1 11 pts. 29,632
  8. Avatar for roarshock 28. roarshock Lv 1 10 pts. 29,628
  9. Avatar for akaaka 29. akaaka Lv 1 9 pts. 29,624
  10. Avatar for Joanna_H 30. Joanna_H Lv 1 8 pts. 29,621

Comments

MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.