Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 29,895
  2. Avatar for Void Crushers 2. Void Crushers 63 pts. 29,889
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 29,886
  4. Avatar for Contenders 4. Contenders 21 pts. 29,794
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 29,762
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 29,632
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 29,621
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 29,574
  9. Avatar for Australia 9. Australia 1 pt. 29,509
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 29,430
  1. Avatar for Alistair69 41. Alistair69 Lv 1 2 pts. 29,358
  2. Avatar for sitlux 42. sitlux Lv 1 2 pts. 29,354
  3. Avatar for Trajan464 43. Trajan464 Lv 1 2 pts. 29,352
  4. Avatar for Mack 44. Mack Lv 1 2 pts. 29,339
  5. Avatar for Oransche 45. Oransche Lv 1 1 pt. 29,311
  6. Avatar for blazegeek 46. blazegeek Lv 1 1 pt. 29,206
  7. Avatar for ProfVince 47. ProfVince Lv 1 1 pt. 29,191
  8. Avatar for AlkiP0Ps 48. AlkiP0Ps Lv 1 1 pt. 29,186
  9. Avatar for hada 49. hada Lv 1 1 pt. 29,151
  10. Avatar for Skippysk8s 50. Skippysk8s Lv 1 1 pt. 29,029

Comments

MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.