Icon representing a puzzle

2260: Revisiting Puzzle 66: Cytochrome

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,287
  2. Avatar for Contenders 2. Contenders 65 pts. 10,238
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,237
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,217
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,198
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 10,192
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,177
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,124
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,048
  10. Avatar for OmHS 10. OmHS 1 pt. 10,044
  1. Avatar for Corvac 41. Corvac Lv 1 3 pts. 9,940
  2. Avatar for mnucer 42. mnucer Lv 1 3 pts. 9,908
  3. Avatar for heather-1 43. heather-1 Lv 1 3 pts. 9,888
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 2 pts. 9,887
  5. Avatar for ucad 45. ucad Lv 1 2 pts. 9,860
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 2 pts. 9,853
  7. Avatar for hada 47. hada Lv 1 2 pts. 9,844
  8. Avatar for Mack 48. Mack Lv 1 2 pts. 9,841
  9. Avatar for Gonegirl 49. Gonegirl Lv 1 1 pt. 9,833
  10. Avatar for frostschutz 50. frostschutz Lv 1 1 pt. 9,828

Comments