Icon representing a puzzle

2260: Revisiting Puzzle 66: Cytochrome

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,287
  2. Avatar for Contenders 2. Contenders 65 pts. 10,238
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,237
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,217
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,198
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 10,192
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,177
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,124
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,048
  10. Avatar for OmHS 10. OmHS 1 pt. 10,044
  1. Avatar for mart0258 61. mart0258 Lv 1 1 pt. 9,663
  2. Avatar for Larini 62. Larini Lv 1 1 pt. 9,655
  3. Avatar for pizpot 63. pizpot Lv 1 1 pt. 9,618
  4. Avatar for pruneau_44 64. pruneau_44 Lv 1 1 pt. 9,596
  5. Avatar for fordesk 65. fordesk Lv 1 1 pt. 9,566
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 9,559
  7. Avatar for kermyt 67. kermyt Lv 1 1 pt. 9,559
  8. Avatar for futsall 68. futsall Lv 1 1 pt. 9,545
  9. Avatar for Mohoernchen 69. Mohoernchen Lv 1 1 pt. 9,536
  10. Avatar for ZionChris 70. ZionChris Lv 1 1 pt. 9,530

Comments