Icon representing a puzzle

2260: Revisiting Puzzle 66: Cytochrome

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,287
  2. Avatar for Contenders 2. Contenders 65 pts. 10,238
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,237
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,217
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,198
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 10,192
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,177
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,124
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,048
  10. Avatar for OmHS 10. OmHS 1 pt. 10,044
  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 9,808
  2. Avatar for RichGuilmain 52. RichGuilmain Lv 1 1 pt. 9,796
  3. Avatar for Trajan464 53. Trajan464 Lv 1 1 pt. 9,791
  4. Avatar for greengrass 54. greengrass Lv 1 1 pt. 9,791
  5. Avatar for zbp 55. zbp Lv 1 1 pt. 9,769
  6. Avatar for carsonfb 56. carsonfb Lv 1 1 pt. 9,755
  7. Avatar for sitlux 57. sitlux Lv 1 1 pt. 9,748
  8. Avatar for Merf 58. Merf Lv 1 1 pt. 9,745
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 9,707
  10. Avatar for fiendish_ghoul 60. fiendish_ghoul Lv 1 1 pt. 9,706

Comments