Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,030
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,832
  3. Avatar for CureCoin 13. CureCoin 1 pt. 9,547
  4. Avatar for Firesign 14. Firesign 1 pt. 8,791

  1. Avatar for Joanna_H 21. Joanna_H Lv 1 28 pts. 10,276
  2. Avatar for Punzi Baker 3 22. Punzi Baker 3 Lv 1 26 pts. 10,270
  3. Avatar for equilibria 23. equilibria Lv 1 24 pts. 10,257
  4. Avatar for drjr 24. drjr Lv 1 22 pts. 10,236
  5. Avatar for Silvercraft 25. Silvercraft Lv 1 21 pts. 10,233
  6. Avatar for alcor29 26. alcor29 Lv 1 19 pts. 10,208
  7. Avatar for Idiotboy 27. Idiotboy Lv 1 18 pts. 10,202
  8. Avatar for phi16 28. phi16 Lv 1 17 pts. 10,187
  9. Avatar for bamh 29. bamh Lv 1 15 pts. 10,159
  10. Avatar for akaaka 30. akaaka Lv 1 14 pts. 10,155

Comments