Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,514
  2. Avatar for Go Science 2. Go Science 68 pts. 10,457
  3. Avatar for Contenders 3. Contenders 44 pts. 10,398
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,395
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,330
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,313
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,283
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 10,276
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,045
  10. Avatar for OmHS 10. OmHS 1 pt. 10,042
  1. Avatar for Joanna_H 21. Joanna_H Lv 1 28 pts. 10,276
  2. Avatar for Punzi Baker 3 22. Punzi Baker 3 Lv 1 26 pts. 10,270
  3. Avatar for equilibria 23. equilibria Lv 1 24 pts. 10,257
  4. Avatar for drjr 24. drjr Lv 1 22 pts. 10,236
  5. Avatar for Silvercraft 25. Silvercraft Lv 1 21 pts. 10,233
  6. Avatar for alcor29 26. alcor29 Lv 1 19 pts. 10,208
  7. Avatar for Idiotboy 27. Idiotboy Lv 1 18 pts. 10,202
  8. Avatar for phi16 28. phi16 Lv 1 17 pts. 10,187
  9. Avatar for bamh 29. bamh Lv 1 15 pts. 10,159
  10. Avatar for akaaka 30. akaaka Lv 1 14 pts. 10,155

Comments