Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,030
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,832
  3. Avatar for CureCoin 13. CureCoin 1 pt. 9,547
  4. Avatar for Firesign 14. Firesign 1 pt. 8,791
  1. Avatar for DoughnutFish 71. DoughnutFish Lv 1 1 pt. 9,358
  2. Avatar for elv 72. elv Lv 1 1 pt. 9,336
  3. Avatar for froschi2 73. froschi2 Lv 1 1 pt. 9,317
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 9,302
  5. Avatar for zbp 75. zbp Lv 1 1 pt. 9,277
  6. Avatar for Swapper242 76. Swapper242 Lv 1 1 pt. 9,265
  7. Avatar for rinze 77. rinze Lv 1 1 pt. 9,264
  8. Avatar for pruneau_44 78. pruneau_44 Lv 1 1 pt. 9,248
  9. Avatar for Dorane 79. Dorane Lv 1 1 pt. 9,225
  10. Avatar for dcosta 80. dcosta Lv 1 1 pt. 9,211

Comments