Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,514
  2. Avatar for Go Science 2. Go Science 68 pts. 10,457
  3. Avatar for Contenders 3. Contenders 44 pts. 10,398
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,395
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,330
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,313
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,283
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 10,276
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,045
  10. Avatar for OmHS 10. OmHS 1 pt. 10,042
  1. Avatar for DoughnutFish 71. DoughnutFish Lv 1 1 pt. 9,358
  2. Avatar for elv 72. elv Lv 1 1 pt. 9,336
  3. Avatar for froschi2 73. froschi2 Lv 1 1 pt. 9,317
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 9,302
  5. Avatar for zbp 75. zbp Lv 1 1 pt. 9,277
  6. Avatar for Swapper242 76. Swapper242 Lv 1 1 pt. 9,265
  7. Avatar for rinze 77. rinze Lv 1 1 pt. 9,264
  8. Avatar for pruneau_44 78. pruneau_44 Lv 1 1 pt. 9,248
  9. Avatar for Dorane 79. Dorane Lv 1 1 pt. 9,225
  10. Avatar for dcosta 80. dcosta Lv 1 1 pt. 9,211

Comments