Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,514
  2. Avatar for Go Science 2. Go Science 68 pts. 10,457
  3. Avatar for Contenders 3. Contenders 44 pts. 10,398
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,395
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,330
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,313
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,283
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 10,276
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,045
  10. Avatar for OmHS 10. OmHS 1 pt. 10,042
  1. Avatar for hansvandenhof 31. hansvandenhof Lv 1 13 pts. 10,143
  2. Avatar for ucad 32. ucad Lv 1 12 pts. 10,136
  3. Avatar for maithra 33. maithra Lv 1 11 pts. 10,120
  4. Avatar for blazegeek 34. blazegeek Lv 1 10 pts. 10,057
  5. Avatar for hada 35. hada Lv 1 9 pts. 10,056
  6. Avatar for stomjoh 36. stomjoh Lv 1 8 pts. 10,055
  7. Avatar for AlphaFold2 37. AlphaFold2 Lv 1 8 pts. 10,045
  8. Avatar for Kayceecyr65 38. Kayceecyr65 Lv 1 7 pts. 10,042
  9. Avatar for AlkiP0Ps 39. AlkiP0Ps Lv 1 6 pts. 10,030
  10. Avatar for Steven Pletsch 40. Steven Pletsch Lv 1 6 pts. 10,001

Comments