Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,397
  2. Avatar for CureCoin 12. CureCoin 1 pt. 9,531
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,518
  4. Avatar for Goons with proteins 14. Goons with proteins 1 pt. 9,019
  1. Avatar for WBarme1234 11. WBarme1234 Lv 1 56 pts. 10,599
  2. Avatar for Timo van der Laan 12. Timo van der Laan Lv 1 52 pts. 10,597
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 49 pts. 10,595
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 46 pts. 10,588
  5. Avatar for gmn 15. gmn Lv 1 43 pts. 10,582
  6. Avatar for BackBuffer 16. BackBuffer Lv 1 40 pts. 10,570
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 38 pts. 10,568
  8. Avatar for akaaka 18. akaaka Lv 1 35 pts. 10,559
  9. Avatar for guineapig 19. guineapig Lv 1 33 pts. 10,558
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 31 pts. 10,517

Comments