Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,397
  2. Avatar for CureCoin 12. CureCoin 1 pt. 9,531
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,518
  4. Avatar for Goons with proteins 14. Goons with proteins 1 pt. 9,019
  1. Avatar for Kayceecyr65 21. Kayceecyr65 Lv 1 29 pts. 10,480
  2. Avatar for g_b 22. g_b Lv 1 27 pts. 10,477
  3. Avatar for alcor29 23. alcor29 Lv 1 25 pts. 10,444
  4. Avatar for AlphaFold2 24. AlphaFold2 Lv 1 23 pts. 10,443
  5. Avatar for roarshock 25. roarshock Lv 1 21 pts. 10,432
  6. Avatar for Joanna_H 26. Joanna_H Lv 1 20 pts. 10,406
  7. Avatar for hansvandenhof 27. hansvandenhof Lv 1 18 pts. 10,365
  8. Avatar for drjr 28. drjr Lv 1 17 pts. 10,359
  9. Avatar for Vinara 29. Vinara Lv 1 16 pts. 10,351
  10. Avatar for NPrincipi 30. NPrincipi Lv 1 14 pts. 10,332

Comments