Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,397
  2. Avatar for CureCoin 12. CureCoin 1 pt. 9,531
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,518
  4. Avatar for Goons with proteins 14. Goons with proteins 1 pt. 9,019
  1. Avatar for georg137 41. georg137 Lv 1 6 pts. 10,047
  2. Avatar for Skippysk8s 42. Skippysk8s Lv 1 5 pts. 10,045
  3. Avatar for RichGuilmain 43. RichGuilmain Lv 1 5 pts. 10,033
  4. Avatar for Deleted player 44. Deleted player 4 pts. 9,975
  5. Avatar for Arne Heessels 45. Arne Heessels Lv 1 4 pts. 9,958
  6. Avatar for Trajan464 46. Trajan464 Lv 1 3 pts. 9,949
  7. Avatar for Idiotboy 47. Idiotboy Lv 1 3 pts. 9,946
  8. Avatar for hada 48. hada Lv 1 3 pts. 9,935
  9. Avatar for Steven Pletsch 49. Steven Pletsch Lv 1 3 pts. 9,898
  10. Avatar for equilibria 50. equilibria Lv 1 2 pts. 9,889

Comments